PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G07950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 324aa    MW: 38109 Da    PI: 9.3452
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G07950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.31.5e-124390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed +l +++k++G ++ k + +  g+ R++k+c +rw ++l
  OMERI01G07950.1 43 KGPWTSWEDSILEKYIKKHGERNCKPVQKNTGLLRCGKSCCLRWMNHL 90
                     79******************************99************97 PP

2Myb_DNA-binding29.31.9e-0998151346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHT...........TTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmg...........kgRtlkqcksrwqk 46 
                      ++++eE+ ++++++++ G++ W++ a  +              Rt++++k++w++
  OMERI01G07950.1  98 AFSKEEENKIINLHRKIGNK-WSRMAIDIKyisletlhykyGERTDNEIKNYWNT 151
                      59******************.9999999999999999999999**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4943894IPR017930Myb domain
SuperFamilySSF466891.92E-1641149IPR009057Homeodomain-like
SMARTSM007171.8E-74292IPR001005SANT/Myb domain
PfamPF002491.1E-94390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-154497IPR009057Homeodomain-like
CDDcd001674.60E-54590No hitNo description
SMARTSM007175.0E-695155IPR001005SANT/Myb domain
PROSITE profilePS512949.47295157IPR017930Myb domain
CDDcd001671.89E-498151No hitNo description
Gene3DG3DSA:1.10.10.601.2E-1798155IPR009057Homeodomain-like
PfamPF002492.3E-898151IPR001005SANT/Myb domain
PROSITE profilePS500904.182177227IPR017877Myb-like domain
SuperFamilySSF466892.34E-6180228IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-7180199IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-7209228IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MHRSGSDPDS DRAHWYRSNS DDESFIDKDK DCRRGTIAPL LKKGPWTSWE DSILEKYIKK  60
HGERNCKPVQ KNTGLLRCGK SCCLRWMNHL RPNLKKWAFS KEEENKIINL HRKIGNKWSR  120
MAIDIKYISL ETLHYKYGER TDNEIKNYWN TRIKKCKNNR LLLYPANVCN DALNEDQYGS  180
QLPGRTDNEI KNYWNTRIKK CKNNHQYGSQ LPGRTDNEIK NYWNTRIKKC KNNRLLLYPA  240
NVCNDALNED QYGSEKLTNN QLEDTTNASI SNILDRRLAS KDYDSIEDQR NRIEVAMEYE  300
IPLLVLKTTN NDIFPSGELS PKPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-15391553106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0029001e-173AP002900.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0443E07.
GenBankAP0034341e-173AP003434.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0452F10.
GenBankAP0149571e-173AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639103.11e-122PREDICTED: transcription factor GAMYB
SwissprotQ0JIC27e-54GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA0A0E0BZB70.0A0A0E0BZB7_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g41166.11e-122(Oryza sativa Japonica Group)
STRINGBGIOSGA017818-PA1e-122(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP154081018
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.13e-45myb domain protein 33